Exclusive Researcher Pricing: Create an Account to Unlock!!

LL-37 – 5 mg

$112.00

Availability: 58 in stock (can be backordered)

Cold Pack Add-On

Helps protect your order during shipping. Single-use only, not reusable.

Product price: $112.00
Total options:
Order total:

LL-37 – 5 mg Vial

CAS Number: 154947-66-7
Molecular Formula: C205H340N60O53
Molecular Weight: ~4493.37 g/mol
Sequence: [LL-37, 37 aa]
Synonyms: Human Cathelicidin LL-37, hCAP-18 Fragment

Description:
LL-37 is a cationic antimicrobial peptide consisting of 37 amino acids, derived from the C-terminal region of the human cathelicidin precursor hCAP-18. It plays a crucial role in the innate immune system, exhibiting broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and certain viruses.

In research models, LL-37 has been studied for its ability to modulate inflammation, promote wound healing, and influence immune signaling pathways through direct interaction with microbial membranes and host cell receptors. Its amphipathic structure allows it to integrate into lipid bilayers, contributing to both antimicrobial defense and tissue regeneration responses.

Form: Lyophilized powder
Amount: 10 mg per vial
Purity: ≥98% (HPLC)
Storage: Store at –20 °C. Protect from light and moisture.
Solubility: Soluble in sterile water, acetic acid, or appropriate buffer.

Applications:
For laboratory research use only. Not for human consumption, diagnostic, or therapeutic purposes.

Disclaimer:
All products sold by SP Biolabs are intended for laboratory research use only. Not for human or veterinary use. Not for diagnostic, therapeutic, or cosmetic purposes. By purchasing, you confirm that you are a qualified professional or entity using these materials for lawful scientific research only.

Scroll to Top